Basic Information | |
---|---|
Taxon OID | 3300031357 Open in IMG/M |
Scaffold ID | Ga0307435_1016751 Open in IMG/M |
Source Dataset Name | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-70 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2154 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Scalinduaceae → Candidatus Scalindua → Candidatus Scalindua rubra | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Massachusetts | |||||||
Coordinates | Lat. (o) | 42.759 | Long. (o) | -70.891 | Alt. (m) | Depth (m) | .7 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F051696 | Metagenome | 143 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307435_10167512 | F051696 | GAGG | MSRVLVSIILALAVIALGCGATQPASAPAAPEDVLSIWHSPPSPQGYPPDMSGEVHLGKSGSPDSELETDSLLVQNRQWLDIVVKSRNIKLFFYLGEPGAVRFEVVQRHSEYSQDKPTLESLVNPHFNPITGRILYGQPVPEETEMGEDTIYSVAIRLFAEGLRNSTSVDSQYTIRFINSNVTEEADISYEVYKLNITPDWGYTYYDDILGPWMMQRLGGEYSESEWEQLYEEWYAQFE |
⦗Top⦘ |