NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307497_10055015

Scaffold Ga0307497_10055015


Overview

Basic Information
Taxon OID3300031226 Open in IMG/M
Scaffold IDGa0307497_10055015 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1411
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.0356Long. (o)-122.86Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008334Metagenome / Metatranscriptome335Y
F036779Metagenome / Metatranscriptome169Y
F090028Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0307497_100550151F036779GGAGGMHVLRILLLVMTAGVLAFILYQAITQQIRRDAFWTVIAVACGFSLNLIYLWFAKPGETPVAMKDKPPVAVEEKAPVVDKANDAGPQPDEVSGKRGLTPNCEKELRRTADLLRFFAN
Ga0307497_100550152F008334AGGMARDGATIFSDLIGELDVLRVSCEKCGRDGCYGLHRLIEKRGRDAKLIDWLGELTAECPKKIARNMNDPCGAKCPDLPKVL
Ga0307497_100550153F090028GGAMPIFSYFAIVGAVLVALFFLADATLEKGTPPVVTSERQGLPEPRRPDPIQTLVTAPAPEPDMTSKAVLAAQPKSAAEGRTPPKKNRVTRDQDRGPFGGDRLFFFGRF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.