Basic Information | |
---|---|
Taxon OID | 3300031200 Open in IMG/M |
Scaffold ID | Ga0307496_10144017 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 503 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Oregon | |||||||
Coordinates | Lat. (o) | 45.0822 | Long. (o) | -123.061 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004265 | Metagenome / Metatranscriptome | 446 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307496_101440171 | F004265 | N/A | MESWRLPEIATPTGTRSPVVLKSEDEARAVLIGLDPGQELGDHQV |
⦗Top⦘ |