Basic Information | |
---|---|
Taxon OID | 3300031197 Open in IMG/M |
Scaffold ID | Ga0255310_10003623 Open in IMG/M |
Source Dataset Name | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Restricted |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4040 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Vancouver, British Columbia | |||||||
Coordinates | Lat. (o) | 49.2598372 | Long. (o) | -123.2459363 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005275 | Metagenome / Metatranscriptome | 406 | N |
F095093 | Metagenome / Metatranscriptome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0255310_100036234 | F005275 | GAG | VPSRSRHDSTPRPPRRPTPPALTLSGIEAASLVKFAYFTDAAPEPGTLLFTAFRRNMPPGVKEFTVRNPVTFFYGIQQTGGLLNIQVRWINPDGVVTRTSDLPMDQSQEGALWTWQVDRLEKRDLAQAGVWVVELLISGHRVGRYPLLVRA |
Ga0255310_100036235 | F095093 | AGGGGG | MKALACTLVAILAMVWPPTAAVALDITFDDVVSVNNPLLTTLDVHGYRFSGSFRTIDTPGGTLPGNGSAVYLHQEASGPGITLTRADGGPFILYEFDAVGQVSLVGHRVGGSFLGATYGLSSLPGFVHFSVPGAWSDLQAVTFSGLLAAATPGALPLPAELALDDVGVGEGPTSVAEPATLALAVITALAGCVLALTRQRSGAFRHR |
⦗Top⦘ |