| Basic Information | |
|---|---|
| Taxon OID | 3300031170 Open in IMG/M |
| Scaffold ID | Ga0307498_10160767 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 753 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 45.654 | Long. (o) | -122.839 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F092753 | Metagenome / Metatranscriptome | 107 | Y |
| F099730 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307498_101607671 | F099730 | N/A | HAMRLYALTELHDPEAIELFITEEDAKRALEDSLRDEPDWRGRLEVTEVELDHEHTSLN |
| Ga0307498_101607672 | F092753 | N/A | MAGEFSPVDKRPLRVGLVFLSAALALAAMLLTGCGGSDDRAKVEASLQQHLGSFNPEDLSFPIGAGPPRLQEKSCKDRHVTTKSGQGYEFHNAGRYFPAGLALWSCVVTFRNSLTLPADVVVKGSEVVAVFPGASQDAPRQPTATV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |