NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307502_10012313

Scaffold Ga0307502_10012313


Overview

Basic Information
Taxon OID3300031164 Open in IMG/M
Scaffold IDGa0307502_10012313 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1500
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Zambryskibacteria → Candidatus Zambryskibacteria bacterium RIFCSPLOWO2_01_FULL_45_21(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.6253Long. (o)-120.532Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019957Metagenome / Metatranscriptome226Y
F025631Metagenome / Metatranscriptome200Y

Sequences

Protein IDFamilyRBSSequence
Ga0307502_100123132F025631GGAGMQMAVSMWWTVGWVVGAVVVLLVAVLLLTITALARRVDGVAQELVSDLDSIAGKTRPLQDVGATNVAVRTITRCLRIARGGAPVEDRYRTSPGWRE
Ga0307502_100123134F019957GAGGMNYVTVLAMSDNQSSWLYTLIAGVVVLLVVIALLEGLRRAVLKLNEDIWQTWVNGKAVVKNTAMTYLLKNTRDSGEELVEELSNHG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.