NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307501_10014625

Scaffold Ga0307501_10014625


Overview

Basic Information
Taxon OID3300031152 Open in IMG/M
Scaffold IDGa0307501_10014625 Open in IMG/M
Source Dataset NameSoil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1388
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)45.9233Long. (o)-120.701Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F000805Metagenome / Metatranscriptome883Y
F001079Metagenome / Metatranscriptome785Y
F001935Metagenome / Metatranscriptome615Y

Sequences

Protein IDFamilyRBSSequence
Ga0307501_100146252F000805AGGAGGMGMPSGESPEHAQQYYQYLQAHKETMQHADTWHVQWIQLAWLWGFVIALSLALLLWIWQYRSTRQKAGPYPVDSFGGYTTELAGPATLFFLLLTVGLTAWAVVLVVGHIVWGQKF
Ga0307501_100146253F001079AGAAGMAVELTPAAPSALPYVSWSSWGMAVIPAADWPLVFGSMQALKGHVQEYPGCQKLEAFVEPEGADYRIHCYTTWDTPEQLEAFLARGYTFERMLADVGLQAEPPRIMEKIF
Ga0307501_100146254F000280GGAGMAEEQRPARPLVGYRDVGEDVRHSRPQIVRSWIILAFLIVLFFAWTLTVYFLEPGLR
Ga0307501_100146255F001935AGGAGGVYLKHLSSLQFLTYISFFAVVMAALFKFVPGRSPPVRETPYPDEELHAHDPKAAKYFLAGGFFLVLGSLHMAVKNLPWLAEYLARTGYAGHLVRDLSNTHVMIVGGGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.