| Basic Information | |
|---|---|
| Taxon OID | 3300031128 Open in IMG/M |
| Scaffold ID | Ga0170823_11768507 Open in IMG/M |
| Source Dataset Name | Oak Summer Coassembly Site 11 - Champenoux / Amance forest |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 646 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | France: Champenoux | |||||||
| Coordinates | Lat. (o) | 48.7184 | Long. (o) | 6.3471 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F023986 | Metagenome / Metatranscriptome | 208 | Y |
| F055024 | Metagenome / Metatranscriptome | 139 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0170823_117685071 | F055024 | N/A | HPIFKTNIRGFLIQMNLNHTDSAKSKTVFLGRKPLLF |
| Ga0170823_117685072 | F023986 | AGGAG | MSLNKWRFALAAVLLVPAHAFAGDEKDQQAYCAYVIEQAQAQRDLLRTPTGVVGVTQPETGLPLQVVGGATLGLADLRKAGLTMEVARKNCELYKATTGAQQEIQYALASLEREALRNRLTLIEQASKSLDVLMEQTSKMVEAQNATRLMLFSLQTTKIRLNADHADTQAKLTA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |