NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0170822_16774949

Scaffold Ga0170822_16774949


Overview

Basic Information
Taxon OID3300031122 Open in IMG/M
Scaffold IDGa0170822_16774949 Open in IMG/M
Source Dataset NameOak Spring Coassembly Site 11 - Champenoux / Amance forest
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3135
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameFrance: Champenoux
CoordinatesLat. (o)48.7184Long. (o)6.3471Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012927Metagenome / Metatranscriptome276Y
F015272Metagenome / Metatranscriptome256Y
F096106Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0170822_167749493F012927GGAMTAYAFLLVILTLISVSALYFFLGRLSQFPCRTIRDVPAFLQPVDSAGMMELLNPQTEEFLHSAMTGVAWRLEQRKSLHFMREHLLRMSHNAHILLEWSNAELKRQIVGQSEEDSECYRDCARKLHVAAIEFRLFAILSLIKINFWLLFRTQSWLPLSTPSLAELNHLGSLRFFDLYSNLTRAVSELGRHYGTEFRDELLRAWAVAA
Ga0170822_167749494F015272N/AVKYVNIAFGLFPPVLQTWLTFLLVRRRAYKSFPFFLTYTVFAVVAEMCKFAVAQFSHHPMTYFYSYWSAEAIYAALGFLAIHEVFRRVFENFKSLLWFKFLLPTMGLGMLAISALIPIVHRAVETAPFLEGIYSLQIAVRCLQIGVFFLIFFLARAFELDYRQYAFGIAVGFGIAAAGILLGTLVRTGLGLKSLMFFEYVPIVAYCIAVTVWLVSFIRAEPEDPFRDFRHLFTPELFLGRIERYKQDVRGIFKS
Ga0170822_167749495F096106GGAMEGQLAFCPACGAPQVRVSRAVETSQQETPASDSALPASPLPALPLNPQLSTTPRIDWKHFLRTAIPLAALTDVLTMTLHPLGIFVFLPANLLWAISRYKRQRPIVLGSGQGARMGAMMGLLSFTFFLAFFLVSVAFQRTQYHDTMVSQIQQISAQNPDPQAQQILQWFTTPDGLVAFTAFALITLLLLCLALGSGSGALVGALRKDKKYL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.