NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308204_10003520

Scaffold Ga0308204_10003520


Overview

Basic Information
Taxon OID3300031092 Open in IMG/M
Scaffold IDGa0308204_10003520 Open in IMG/M
Source Dataset NameMetatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2286
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004359Metagenome / Metatranscriptome442Y
F023069Metagenome / Metatranscriptome211Y
F093332Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0308204_100035202F023069GAGMDTNGARASTAPGEQEPSPPEALRRLQQQIEELQAYLTHFVSAKVDGFRLSGQKLALWTALGLIGLLALAAIVITAIVLLLDGAAAGLGLLFGEQLWLGQVVVGGGLLLLLALGIFIGMRIWQHKSLQQKVQQYDERQLQQRAAFGHSVADRATEDAALQHRR
Ga0308204_100035203F093332N/AMQRTLADMQTTLKEAADVRWWTQQYPWYAVGAAAVAGFVTATQVLTPSDHRAPPAPPAQAQSAGHSSWISSLFELVRSTLMGAIMEGIRASTQPSERTQAEQVQTRADVY
Ga0308204_100035204F004359AGGAGMYEQFEHLLRGLVSPLDHLKRTYSELADDFFNKLRYQIEVTQNELRDGEQLEVYYTAQGREPILVSRICYLEPHLLVLYGQDDHNNDCKVLANLFTASLILTLVRHGDPAKHRTVSFVEPSKGT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.