NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265760_10046335

Scaffold Ga0265760_10046335


Overview

Basic Information
Taxon OID3300031090 Open in IMG/M
Scaffold IDGa0265760_10046335 Open in IMG/M
Source Dataset NameMetatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1304
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9979Long. (o)10.7895Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002396Metagenome / Metatranscriptome564Y
F003157Metagenome / Metatranscriptome504Y
F004392Metagenome / Metatranscriptome440N

Sequences

Protein IDFamilyRBSSequence
Ga0265760_100463352F003157AGGAGGMFDPDANQKRDNTDLWGFARFGGLDRLDWLMILISVLLGTIAKQHHFLDLPDWFLEWVSPFLLMAFGYKARRKITEVVESRRDRGKDTREE
Ga0265760_100463353F002396GAGGMRSLFPATYDRADVLMSAGCSTFVSAALILVIPRVGIVLLEILLGLFFIGCALAARARLRIQARSEVKEGPEGSTNAKAKWFDRYDVLMILTVIVIYSSVSGLLRHAGLSEGTVGILPLILFAAGILLKPRAVQFIERRRKDRKAETHDGRSHMDVGEKQEIARKETVERCQ
Ga0265760_100463354F004392AGGAMPVNGPETIADPKTSQPVPSEARSGRAAKNAKPAVGRGASTRHRRDRQDGSETNGEERFFLASANRSGDVPTLGRECATEAEAIIEAFREKVNLYRVTEFQTRADIGRSGEPIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.