Basic Information | |
---|---|
Taxon OID | 3300031058 Open in IMG/M |
Scaffold ID | Ga0308189_10216660 Open in IMG/M |
Source Dataset Name | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 703 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Colorado | |||||||
Coordinates | Lat. (o) | 38.9206 | Long. (o) | -106.9489 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052960 | Metagenome / Metatranscriptome | 142 | N |
F085661 | Metagenome / Metatranscriptome | 111 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308189_102166601 | F085661 | GGA | MRKLIIAFIVSLGLLAAAPAQAGIPDLYSGSWPAKLMPSNEALGTITWVPVSEEWGRGVLDQPWGGAPFTNCPSKGQTRFFLGRYGTGGKLIACTVGSDGKRLHGRYDGQGGEFRPGSFDVSIITAPSDDEQEFEGVYVEDG |
Ga0308189_102166602 | F052960 | N/A | VLAGCGGGSSSAKTSDVEKAILVRSPDSSQVTCMRHGSYQGKTLFRCQSDVATSVREMRPESSCYTFEHGKLDNV |
⦗Top⦘ |