NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265773_1000227

Scaffold Ga0265773_1000227


Overview

Basic Information
Taxon OID3300031018 Open in IMG/M
Scaffold IDGa0265773_1000227 Open in IMG/M
Source Dataset NameMetatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1936
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9989Long. (o)10.7903Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000586Metagenome / Metatranscriptome1007Y
F019886Metagenome / Metatranscriptome227Y

Sequences

Protein IDFamilyRBSSequence
Ga0265773_10002271F019886N/APQWQGLLAGSGEEIRKAVLSGIRKQETSVELEAIKQALNLEKTVEGADLVINRFKLQVV
Ga0265773_10002272F000586N/AMWGSVPETNSNHQQFHTPCFMAPDIIQADMNHADPNTMRARARQATEILKTQLLGTGAIEPLVALYFDDHIEQVEFQDPSVLEHFDVRTARSFDYLRTLVRIKNPQAAMITLDVQMGPFESDERDVLADTTAIFLMLDSPLLTIQVLLPYTRCGGRTAVSNVHYTEMPGDEGGTPCPLFKIFTDVPVAVC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.