| Basic Information | |
|---|---|
| Taxon OID | 3300030728 Open in IMG/M |
| Scaffold ID | Ga0308136_1009089 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_940_32.3 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2133 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Western Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 75.0007 | Long. (o) | -150.0027 | Alt. (m) | Depth (m) | 146 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F039091 | Metagenome / Metatranscriptome | 164 | N |
| F077940 | Metagenome / Metatranscriptome | 117 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0308136_10090891 | F039091 | GGCGG | MPITAQSLRLGPWRDGVNYSLPAEEISPAGLYDMENCTVGLAGEVKKRKGYAKFNATAMNSGATVTGLGQVVLAGTEKVFAFCGDKFFDVSGGTATDRSGSATVTAGNDNTWNWVLAGSTLVAANGVDTDAVTWAGGTANIAALDDDSRFTKPTWPAFWENRLWLGNEN |
| Ga0308136_10090894 | F077940 | AGG | MAKRTQQLNLPSEIAEIAQSAAPVAVVAPEVTPDQIAQLILKGSDNTKAAIRKALDLDKTHARVRKNKNQTNSQVRNTVKAIGEVTHADDYVPDPPGRISDRGPEAVRIWQERWLDNNGDNLSEYDLDHMALEAQE |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |