Basic Information | |
---|---|
Taxon OID | 3300030721 Open in IMG/M |
Scaffold ID | Ga0308133_1048501 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 571 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 74.0136 | Long. (o) | -139.5971 | Alt. (m) | Depth (m) | 20 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003867 | Metagenome / Metatranscriptome | 464 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308133_10485011 | F003867 | N/A | DFKAASKVREIEHTDYVATHKDYTESIDALDEGVATLKKQSHDVKQAAASLMQISASNIIPAESKKVIDAFLAQDPDDENLAVAAPEANAYEFQAQGIVDMLTKLAGKFEDERTDLEKEETNARQAFEMLSQDLKAQIGQATSARTEKSEAKAKALQSSADAKGDLQDTTTTRDDDSKYLADLTATCEQK |
⦗Top⦘ |