NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302046_10347993

Scaffold Ga0302046_10347993


Overview

Basic Information
Taxon OID3300030620 Open in IMG/M
Scaffold IDGa0302046_10347993 Open in IMG/M
Source Dataset NameSoil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1218
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)42.9888Long. (o)-108.3994Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016640Metagenome / Metatranscriptome245Y
F021438Metagenome / Metatranscriptome219Y
F046231Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0302046_103479931F016640AGGAGMTSIIIVVVVMACAVWMAWSRWNYWRTPISPLPSAERSSQTRAFEAFTHGNTCLASGQWADATAAFEQARALDPKRPYVAERLAEVGRRQHEVPATVPVAAGQ
Ga0302046_103479933F046231AGGAMATGRSQPSIVIDVQVLVTHAASVTTMEREMGNPPRLIRTPDVCYLFQRRDEERLPGLVDRWESYGIAAQVVLIPPNAGQSARDSHRTL
Ga0302046_103479934F021438N/ATPTQLRLTQDLLERADALIEVMAADPEVRALGMPTRTAVLRLAIARGLRDLERQYQRPTPAAASASHLPTIPHDATPHSREGTLSHVYAGRIGEDQAPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.