Basic Information | |
---|---|
Taxon OID | 3300030569 Open in IMG/M |
Scaffold ID | Ga0247628_1097937 Open in IMG/M |
Source Dataset Name | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 747 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | France: Rollainville | |||||||
Coordinates | Lat. (o) | 48.3625 | Long. (o) | 5.7397 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005375 | Metagenome / Metatranscriptome | 402 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0247628_10979371 | F005375 | N/A | PKCQIHCEETECAKCKIHCDKPQCNVRCPKDLCEKKDCPKCETVCSPANCRTQCEAPNAVCTPMCEATKCDWKCKKPITCPKPKCELVCERPACDTRARKDGTKAGCCSCSDPANLAATIRAANSLVEESSEVSEMMPSFMEVMHTIKADSQEGKGMCCKCAA |
⦗Top⦘ |