| Basic Information | |
|---|---|
| Taxon OID | 3300030560 Open in IMG/M |
| Scaffold ID | Ga0257187_1093481 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of decayed wood fungal communities from Pinus contorta in Bitterroot National Forest, Montana, United States - GP2-2E (Eukaryote Community Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 676 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Metatranscriptome Of Decayed Wood Fungal Communities From Pinus Contorta In National Forests From Montana, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Montana | |||||||
| Coordinates | Lat. (o) | 45.755 | Long. (o) | -113.9106 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024489 | Metagenome / Metatranscriptome | 205 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257187_10934811 | F024489 | N/A | HMIDPINFKPCCNIPVLIEDHSSGDVICSECGVVHSERLISDEAEYRVFNDDSQSTSRIRVGTAYNPLLEHKLTSSGKWEREEKEFLWDGFKNVDEVMDRMFPDIKNTAVQFRAKELFQKAFHIQVRQKAIMKRQRFAKRKQYVVASIYWAFHENKITSFTLEDLNPLLDGITVSRPSLKKCLEELQVRA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |