Basic Information | |
---|---|
Taxon OID | 3300029827 Open in IMG/M |
Scaffold ID | Ga0134606_10163878 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Battelle Memorial Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 689 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Barataria Bay | |||||||
Coordinates | Lat. (o) | 29.468 | Long. (o) | -89.882 | Alt. (m) | Depth (m) | .08 to .12 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069001 | Metagenome / Metatranscriptome | 124 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134606_101638781 | F069001 | GGAG | MKVVFGGKKNLELTAKKPSGEKQQRFCEICGTYVGALTSKDWELEGRICKTCFEAYASSLEIEMDASNQSWRVKRHSREMGWDRDRLSRFI |
⦗Top⦘ |