Basic Information | |
---|---|
Taxon OID | 3300029826 Open in IMG/M |
Scaffold ID | Ga0134619_1035275 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from Jimmy Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - N0247 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Battelle Memorial Institute |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1119 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From New Orleans, Usa To Study Impact Of Deep Water Horizon Explosion |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Bay Jimmy | |||||||
Coordinates | Lat. (o) | 29.44 | Long. (o) | -89.903 | Alt. (m) | Depth (m) | .02 to .04 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024682 | Metagenome / Metatranscriptome | 205 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0134619_10352752 | F024682 | AGG | LNAEDELISKLKKEIGKTLPAMFAGMAESMLENNKDVIIAWLKENKDLVKQVIES |
⦗Top⦘ |