NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134854_1020000

Scaffold Ga0134854_1020000


Overview

Basic Information
Taxon OID3300029822 Open in IMG/M
Scaffold IDGa0134854_1020000 Open in IMG/M
Source Dataset NameLiquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChongqing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2130
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location NameChina: Chengdu
CoordinatesLat. (o)30.65Long. (o)104.06Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009968Metagenome / Metatranscriptome310Y
F011593Metagenome / Metatranscriptome289Y

Sequences

Protein IDFamilyRBSSequence
Ga0134854_10200002F009968GGAGGVRPSTCTGCRSHYRERHWWIFEIDFCGLDGEVVGFSCPIGCIDTEGCTAYERRPAWPVGAIA
Ga0134854_10200006F011593AGGTGGMTDNGLAAPEWCLGCPSPIYDDRRGEWDWYCRQHSPTGIKCSNVAVLRERCYRVREYFSNREATL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.