NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0134854_1007295

Scaffold Ga0134854_1007295


Overview

Basic Information
Taxon OID3300029822 Open in IMG/M
Scaffold IDGa0134854_1007295 Open in IMG/M
Source Dataset NameLiquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChongqing University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5248
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud → Liquor Fermentation Pit Mud Microbial Communities From Chongqing University, China

Source Dataset Sampling Location
Location NameChina: Chengdu
CoordinatesLat. (o)30.65Long. (o)104.06Alt. (m)Depth (m).01
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093907Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0134854_10072952F093907GGAGGMKAKIKTMQDLAATFPDIYREHKLLCHAQRNAGSVVVTVIDKYNVSFQVRGGSPQEAYANLVRKLEAL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.