Basic Information | |
---|---|
Taxon OID | 3300029799 Open in IMG/M |
Scaffold ID | Ga0311022_10565004 Open in IMG/M |
Source Dataset Name | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Toronto |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 561 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Toronto, Ontario, canada | |||||||
Coordinates | Lat. (o) | 43.5479 | Long. (o) | -79.6609 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002994 | Metagenome / Metatranscriptome | 514 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0311022_105650041 | F002994 | N/A | KVKNAYALQVEKCEKLSSELSTCHETIDNLRNENAKLIAKVDSHICIDSISNPRDDNVDLLARIDELNVSIASLRIENEKLLAKAKDFDVCNVTISNLRSENDILHAKVIELKSCKPSTSIVEHVSICTRCRDVDINAIHDHMALIKQQNDHIAKLDAKIAEHNLENEKFKFARSMLYNGRRPGIKD |
⦗Top⦘ |