NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0183757_1000041

Scaffold Ga0183757_1000041


Overview

Basic Information
Taxon OID3300029787 Open in IMG/M
Scaffold IDGa0183757_1000041 Open in IMG/M
Source Dataset NameMarine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)73431
Total Scaffold Genes108 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (29.63%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameMediterranean Sea: TARA_018
CoordinatesLat. (o)35.7528Long. (o)14.2765Alt. (m)Depth (m)60
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001222Metagenome / Metatranscriptome743Y
F012280Metagenome / Metatranscriptome282Y
F099888Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0183757_100004123F012280N/AMPSKLKPSTKEYQKDSRGRMTQKWKWIHYTPSNTSTKELKKMYESLSFRRKKNIIKRELIKRNEII
Ga0183757_100004169F099888GGAMRKTYLVPRSNVGIGGFITVSSGVRYHVPSWTVVEEDTSFEDIIMEKKPFEELFEEKEEKVWKFISARSGEEYIVRYNARNELSCSCWGYIAHRNCKHIKEVKEKL
Ga0183757_100004199F001222N/AMSNIKEIVREVINENAKVNFAGHQFMLKVDVNEDPQKKGVKIQFLPTEFGSITKTEQNDIAIELEQRLEQGLNQYDFKVERDRNLKDKTIIGFFIYIEYFDRMVRAALKQTNPNSSPAADDNEEI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.