


| Basic Information | |
|---|---|
| Taxon OID | 3300029625 Open in IMG/M |
| Scaffold ID | Ga0311297_1121652 Open in IMG/M |
| Source Dataset Name | Mildly acidic thermal spring sediment microbial community from Yellowstone National Park, USA - SJ3 Spring |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9221 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (61.54%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Thermal Spring Sediment Microbial Community From Yellowstone National Park, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Smokejumper Geyser Basin, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.41595 | Long. (o) | -110.95576667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013155 | Metagenome / Metatranscriptome | 274 | Y |
| F075483 | Metagenome / Metatranscriptome | 119 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0311297_11216528 | F013155 | GAG | MELYQAAVIAIALANLAVTVWLLRLLLPVWRELRRIVFALDHYDFDKLAKQFLGDEKPLAESVIVKTSEKKEEGYREISITRVYKKPLDPREIQEGFVRQMAEKLQ |
| Ga0311297_11216529 | F075483 | AGAAG | MIELLAVQAITTAALAFFVIKLRRELYPMIAAAGQPYASFWVRSVDVLVLTAPQFEAAKTAVRVRLLFTEELHLTYSLRIYDVAMDSSSRVFYKEWRAWMQGDDRYVCEVERPRGLARIYTKAIDVFCKEKKPPKEVVVLPSRWRKRRYKRWTKPEPSRSAPP |
| ⦗Top⦘ |