NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0243782_100571

Scaffold Ga0243782_100571


Overview

Basic Information
Taxon OID3300029332 Open in IMG/M
Scaffold IDGa0243782_100571 Open in IMG/M
Source Dataset NameHuman feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 042_10_27_stool_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterInstitute for Genome Sciences, University of Maryland School of Medicine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)46851
Total Scaffold Genes48 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (27.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces → Human Feces Microbial Communities From Cholera Patients In Hospital, Baltimore, Maryland, Usa

Source Dataset Sampling Location
Location NameUSA: Baltimore
CoordinatesLat. (o)39.28846264Long. (o)-76.62594594Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F060985Metagenome / Metatranscriptome132N
F094005Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0243782_10057144F094005N/AMKKETIKLKEGDQVIYQDKTLMEKANVVSIDKKNGTAILSNMVIITRTTNLEGQFTRLDGKGNAIILPCTPENEQKYNSFVAYHHSKKSLEAIKKWLDDNGKHKDDETLEKVITLDKKLKKLIEKLNE
Ga0243782_10057145F032312N/AMARIKDYDEDLSAPKLLRERARDSKGRFIKKDLPPYLGSEQVLKPKNYYHFDSHGNYKGSSMNFDALVCLGFTWFKLLGVALMILLWPIVFIYALHDGIEGYPFKKYAIPYTFILVVWFIVFLYGLVS
Ga0243782_10057146F060985GGAMSNIDEKVKNNFTIEMRIFENYEKVKYEIIKVIDFLRHAETNMGMCRIFDNQNHEFWHSVIKPWFQPERFGITHLWFSSGFSHIGYGEYHIIRGNRWLKTPIDRIDREYYIFGYWFPIYKKYIPYRIRILKLALKDLERIKKEYSDKV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.