Basic Information | |
---|---|
Taxon OID | 3300029327 Open in IMG/M |
Scaffold ID | Ga0243509_104657 Open in IMG/M |
Source Dataset Name | Anode biofilm microbial communities from glucose-fed MFC - GM-anode biofilm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Tokyo University of Pharmacy and Life Sciences |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4897 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Industrial Production → Engineered Product → Bioanode → Unclassified → Anode Biofilm → Electrode-Associated Soil And Biofilms Microbial Communities From Mfcs In Japan |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan: Tokyo | |||||||
Coordinates | Lat. (o) | 35.638 | Long. (o) | 139.3817 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021619 | Metagenome / Metatranscriptome | 218 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0243509_1046576 | F021619 | N/A | MREELLIDLRRTQLLAVDTSLDDARRALARAARIPTAFAAELRAVLAVVAELERRVLADAES |
⦗Top⦘ |