Basic Information | |
---|---|
Taxon OID | 3300029309 Open in IMG/M |
Scaffold ID | Ga0183683_1016586 Open in IMG/M |
Source Dataset Name | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1627 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage MEDS1 group | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Pacific Ocean: TARA_100 | |||||||
Coordinates | Lat. (o) | -13.0023 | Long. (o) | -95.9759 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001724 | Metagenome / Metatranscriptome | 645 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0183683_10165863 | F001724 | N/A | MEEKEKNKQLEDEKPDYQEKITFLVSTVAQGFILTWCLLVLSLGYVKLPNKLFGLDIPDQPRVDSTFAAGLLGNILGGLGISVNAAQGAKKKKKENENGVIGDSSGSTQTIIIRQPIELLTSKPDVIKVDSSKSKT |
⦗Top⦘ |