NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119857_1004435

Scaffold Ga0119857_1004435


Overview

Basic Information
Taxon OID3300029304 Open in IMG/M
Scaffold IDGa0119857_1004435 Open in IMG/M
Source Dataset NameAnaerobic bioreactor microbial community of Freshwater lake and wastewater samples from Australia - AOM-metagenome-Illumina
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3235
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Anaerobic Bioreactor → Anaerobic Bioreactor Microbial Community Of Freshwater Lake And Wastewater Samples From Australia

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011712Metagenome / Metatranscriptome288Y

Sequences

Protein IDFamilyRBSSequence
Ga0119857_10044353F011712AGGAGGMDLAITLGLGGWLLLIAGAIAFGVVAQFIGRAETGIEWLVDAIAAGIGALVASEFIVSWRTFEPVWDGLALVPALVGGLVVGIVVEVATRRITGGTYSGRSMAAA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.