| Basic Information | |
|---|---|
| Taxon OID | 3300029302 Open in IMG/M |
| Scaffold ID | Ga0135227_1041547 Open in IMG/M |
| Source Dataset Name | Marine harbor viral communities from the Indian Ocean - SRB3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Michigan State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 544 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor → Marine Harbor Viral Communities From The Pacific And Indian Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indian Ocean | |||||||
| Coordinates | Lat. (o) | 3.715 | Long. (o) | 105.408333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012280 | Metagenome / Metatranscriptome | 282 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0135227_10415472 | F012280 | AGGAG | MPPKIKPSTKEYVRDARGRMTNKWSWKHYTPSSISTEELLKYYESPSYKRKKAIIKKELIKRNALN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |