NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247841_10074885

Scaffold Ga0247841_10074885


Overview

Basic Information
Taxon OID3300029286 Open in IMG/M
Scaffold IDGa0247841_10074885 Open in IMG/M
Source Dataset NameFreshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyRestricted
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).


Scaffold Components
Scaffold Length (bps)2941
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location
Location NameSpain: Castile-La Mancha
CoordinatesLat. (o)39.9879Long. (o)-1.8737Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000557Metagenome / Metatranscriptome1026N

Sequences

Protein IDFamilyRBSSequence
Ga0247841_100748855F000557N/AMKLQDLTIDQFQRIAALEFSPVLTDYDKRAGVVAIVEGVDISIVREMPAKGLTKRYKTIIAEWNELPTLAYRRRFKAGGKWWIPTVFTDELTAGQLIDLMDTDTTDEKKLVQNLHRIMATLCREGGFLGWFPEKYDGASHQERAELLKAHAKIGDVWGVVSFFL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.