Basic Information | |
---|---|
Taxon OID | 3300029233 Open in IMG/M |
Scaffold ID | Ga0168116_1001682 Open in IMG/M |
Source Dataset Name | Sewage sludge microbial communities from sewage treatment plant in Sweden - SWESTP59 - Uppsala-primary/surplus 201 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4623 |
Total Scaffold Genes | 7 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 59.844519 | Long. (o) | 17.659844 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F011177 | Metagenome / Metatranscriptome | 294 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0168116_10016822 | F011177 | AGGAGG | MSQPEPLLPAEAARRLGVETRVIIQAMYEERLPRVRLADGTLGIPAEALESFDHA |
⦗Top⦘ |