


| Basic Information | |
|---|---|
| Taxon OID | 3300029008 Open in IMG/M |
| Scaffold ID | Ga0169638_100432 Open in IMG/M |
| Source Dataset Name | Human fecal microbial communities from infant at 12 months in Denmark - 326_12M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Genomics Institute (BGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 30774 |
| Total Scaffold Genes | 28 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 25 (89.29%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Denmark | |||||||
| Coordinates | Lat. (o) | 55.678 | Long. (o) | 12.531 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062845 | Metagenome | 130 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0169638_10043210 | F062845 | AGGGGG | MKKTPFILHEKFRSDNNEQRKERFQKEFERYIIDGLLNALPSRSCA |
| ⦗Top⦘ |