NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307308_10217047

Scaffold Ga0307308_10217047


Overview

Basic Information
Taxon OID3300028884 Open in IMG/M
Scaffold IDGa0307308_10217047 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)917
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019580Metagenome / Metatranscriptome229Y
F091817Metagenome / Metatranscriptome107Y
F101096Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0307308_102170471F019580GAGVYVQHLGTLTFLAFLADLAVVVAVLFKLLPGRAPPVRNEPYSPGELGAHDRKLPKYFLAGAGFLVLGGLHMVAKNVPWVADWLARAGYAGHLVRDLSNTHLMIVGGGTLIATGIVWYALPRIVGRPLASNGLAQSAFWFTAIGLFLFYIAFVGNGIAMGRLVAHGWEY
Ga0307308_102170472F091817AGAAGGMAEQEQPERRRRGLRPGRPLYGYRDTGEPPGDRHSRRAVVRAWLILAVMILLYLAVVLTIYGVEPGLR
Ga0307308_102170473F101096N/APGCERFDVFFYAEPGESVRVHCYTTWDTLVQLEAFLERGYTFERLLADVDADIKLERSLVMEKVF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.