NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307312_10037406

Scaffold Ga0307312_10037406


Overview

Basic Information
Taxon OID3300028828 Open in IMG/M
Scaffold IDGa0307312_10037406 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2855
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006057Metagenome / Metatranscriptome382Y
F008298Metagenome / Metatranscriptome335Y
F010456Metagenome / Metatranscriptome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0307312_100374061F010456N/AGICMRKLTSTLVAAVALVALPHIALAQRARSAAGGPKNEIGIDLGAAYSHVGSGCAADCSGLGIGTPIDIRWGFLAKGQLSFEPRFSLNYTSGFGGHDLSFNPDLNVIYRLRTSTPRKGMYLTGGLGLAIDNSASGGPSNTASQLSLNAGVGKRIPMESNAWRVEGFFRYNLENSGKGIPSRLDIGARLGMSFWR
Ga0307312_100374062F006057GGAGGMRKLFGGIVLAALALSLPAAAQAQRRTTAVSGATTHEFGVDLGLAYVKPSGVDGGINLQTPVDIRYGFVPRSGKMMWEPRLSLTFNTVGGNTSYLFTPQVNLLYANSTGGHRRGMYFTGGAGLQMGDLGGGSGTAIKLEGGVGWRKPYEGAAWRYEVGLQWVSKSAELGPFADYIAIGGRIGISLWH
Ga0307312_100374064F008298GGAGGMKRMLMVIAAAVLAGSPLAAQWQGMPAWNSPKGGTGVTINGDLGVPNADAGKGTAFGARATLGLANISLTAGISSWKPKGFSGSTTTLGGVAQFRVIGGSLIPVALNLQLGGSTSSAITGTSSMPKLTNLLAGAGLSVNVPTPGLSIEPYLSVSNRWHKPEGGSTVSNIGWVLGANVGFGMIGLHVAYDSENFGGGTTAGVIGIGAHVALKAPIGM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.