NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307305_10021360

Scaffold Ga0307305_10021360


Overview

Basic Information
Taxon OID3300028807 Open in IMG/M
Scaffold IDGa0307305_10021360 Open in IMG/M
Source Dataset NameSoil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2916
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The East River Watershed Near Crested Butte, Colorado, United States

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.9206Long. (o)-106.9489Alt. (m)Depth (m)20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002111Metagenome / Metatranscriptome592Y
F008327Metagenome / Metatranscriptome335Y
F012223Metagenome / Metatranscriptome282Y

Sequences

Protein IDFamilyRBSSequence
Ga0307305_100213601F012223N/AVGFIWAWKAGAFHDLERQAAIPLLIEEEDYYTPDWALDEEEWDE
Ga0307305_100213602F008327AGGAGGMSMPTGDTPEKVEQFYLYLNGHQETTRPIESWHVDWLSVAWLWGFVFALLAVLLLWVRQYRTTRQRAGIYPVDTFGGWTTEGAGPATGFFLLFTVLIVVFAVVLIVGHLVWGQKF
Ga0307305_100213603F002111AGAAGMAAISVLPFVSYSSMTETLVPAAQWPTVYSSLQALKGHVQEYPGCQSFDVFVRAEGDGDVLVHCYTTWDTPGQLEVFLERGYTFERLLSDVGSGLTPSRSLVMEKVF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.