| Basic Information | |
|---|---|
| Taxon OID | 3300028804 Open in IMG/M |
| Scaffold ID | Ga0268298_10009212 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 8456 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (90.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Studying Microbial Cell-Cell Associations In A Wide Range Of Aquatic Ecosystems |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netherlands: Nijmegen, Gelderland | |||||||
| Coordinates | Lat. (o) | 51.82 | Long. (o) | 5.87 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024268 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0268298_100092129 | F024268 | AGGAGG | MAISELYTGTEAVSTTEHSLTTDTSGPDADTTDGVFQAFLDVSDMVAGDQLQIRVYEKVRSGDTQRIVFQTILTGTQSEPIWVSPSLILLHGWDITCDALAGTITVNWSIRKVA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |