Basic Information | |
---|---|
Taxon OID | 3300028471 Open in IMG/M |
Scaffold ID | Ga0268323_1022440 Open in IMG/M |
Source Dataset Name | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 500 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Michigan | |||||||
Coordinates | Lat. (o) | 42.39 | Long. (o) | -85.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037084 | Metagenome | 168 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0268323_10224401 | F037084 | AGG | MGWIGCIRCKKSRRDIVARTFALIAPIHPVLHQVSCSYETTPNAPKHYETHQNMSLGSNGVDQVHSLQKIQCDFMSRTFVLIEPVQYVLKQVSCSYGTIPNAP |
⦗Top⦘ |