NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210366_10319760

Scaffold Ga0210366_10319760


Overview

Basic Information
Taxon OID3300028420 Open in IMG/M
Scaffold IDGa0210366_10319760 Open in IMG/M
Source Dataset NameMetatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)627
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Washington
CoordinatesLat. (o)46.27Long. (o)-123.946Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000545Metagenome / Metatranscriptome1038Y
F002241Metagenome / Metatranscriptome579Y

Sequences

Protein IDFamilyRBSSequence
Ga0210366_103197602F002241AGGMSRPHSIRYIRQLMEWGFDKEFIAKDCGINLASLETRLRRQEERERNGNQRTEPRTGSGKSDS
Ga0210366_103197603F000545N/ADESWFRWALGFSEMIKDAHPFPCSNCKLVTPHTEMKRYNTEDVAEAPEEVWLVECQRCFLQRIIYPSDRVASKEDDIIRCEQCGGWKMKSGKCRICRLAAGFEQISVKYWTGNATMERPYNDEQTPLY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.