| Basic Information | |
|---|---|
| Taxon OID | 3300028287 Open in IMG/M |
| Scaffold ID | Ga0257126_1002545 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 11932 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (87.50%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | Depth (m) | 120 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002542 | Metagenome / Metatranscriptome | 550 | Y |
| F030747 | Metagenome / Metatranscriptome | 184 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257126_100254511 | F002542 | AGGA | MHPTYLGWQVDWPVFIKRPLMADSKTWSQGEHFNWLERGIDQDKVATLYTSGYVHHNKELEVQTKVGDRLSELSGKQLETLVNLLNAEVKARTSSVSEFGTKKCKKSKIDDKQRGLIRRFLNNSRWITEDFYTIRDRILNDT |
| Ga0257126_10025455 | F030747 | AGGA | MDLMNLKPSSDTVEVTLKHPNTGDTLKNDDKSDMTVTVHASHSKEYKAAMHEQTNKRLKAMQSGKKQEITAQDMEEAGLTLLSKITAEWNITYGGEKPKLTVAKAKDLYDEVFWIKDQIEEALAESLDFTKA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |