NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0257121_1105486

Scaffold Ga0257121_1105486


Overview

Basic Information
Taxon OID3300028198 Open in IMG/M
Scaffold IDGa0257121_1105486 Open in IMG/M
Source Dataset NameMarine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_100
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1016
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Inlet → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)100
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008577Metagenome / Metatranscriptome331Y
F078296Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0257121_11054861F008577N/AKNKMKLTWEEIKDIANRLDEIVGNHFHEAMYDIIFERESMCEIGEVTDEDILLIKEQLKRIL
Ga0257121_11054863F078296N/AMSKMIKTFEEKSYSLSTGFTKDLDLFKVNATVWSYVNFNMNNEDYDHEINDIELSYEINGKYCRYQGFKELYGKLYGEDSFEKFEQDLMWDFKQAYYDTTSYKRNPSTIK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.