| Basic Information | |
|---|---|
| Taxon OID | 3300028190 Open in IMG/M |
| Scaffold ID | Ga0257108_1078028 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 987 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Northeast Subartic Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 50.0 | Long. (o) | -145.0 | Alt. (m) | Depth (m) | 1000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F036923 | Metagenome | 169 | Y |
| F066688 | Metagenome | 126 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0257108_10780282 | F036923 | GGAG | MMKIELTDEEVTTIMVALDGYGAQKRIEWLDSRAPPDAPDMGDEELLDEAGSAEWCWQKLFGFQQDFRNSIADAVGEGEQPNNTTNASVDPFTLPTRSNYENMK |
| Ga0257108_10780283 | F066688 | GAG | MNYTSPYAKNVGKMHNHEVVALAKNRFTDADTMLAITKHWYRLGKEYLARNENITPEAAQELWNHKGYVFKAIMLSKGTIELTDKEYTETYRKYFKNNKRSSWRMQQAFLGSYYWQRDSNSSNTPTGLLEEIYADLPEEEARRSYTLERFINHNNC |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |