NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233397_1102059

Scaffold Ga0233397_1102059


Overview

Basic Information
Taxon OID3300028111 Open in IMG/M
Scaffold IDGa0233397_1102059 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 35D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)718
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056906Metagenome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0233397_11020591F056906N/ADGMTTYHDKGTHSDDHEIINFLHIAKKNDNTKVVITENYNNVKGMITQDDVVIRNNIDKYREVLLLNWFHKNLAQLGNEPELQYGWRDSWIEWQTDLWKNNSKIPIASAVAEWMYKLFDDNFAEIKTIPEITKVFNWSVMYNSSQATVDEFKKIGYNYTVEEHDKWLTSQSKILGYWQAIKNNIDTPLDLDDDVHKGLALALHGKTHNLDRQQVESKFKLLP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.