NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233397_1013928

Scaffold Ga0233397_1013928


Overview

Basic Information
Taxon OID3300028111 Open in IMG/M
Scaffold IDGa0233397_1013928 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 35D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2892
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002549Metagenome / Metatranscriptome549Y

Sequences

Protein IDFamilyRBSSequence
Ga0233397_10139283F002549N/AVVVSKLLNLLTGGGTSLIDKAVEVADKFIETPEEKKAFIEKAYEQEVEDRRAARDLGKNKATPDILTYVTLVIALGLATAIFTDFLDWKNLTEVQKGLITTFSGFFLRTLGDVYGYWFGSSMGSSNKTKDLTKLMRK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.