NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247723_1005306

Scaffold Ga0247723_1005306


Overview

Basic Information
Taxon OID3300028025 Open in IMG/M
Scaffold IDGa0247723_1005306 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5836
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (60.00%)
Novel Protein Genes5 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Associated Families5

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002135Metagenome / Metatranscriptome590Y
F002162Metagenome / Metatranscriptome588Y
F007469Metagenome / Metatranscriptome350Y
F020681Metagenome / Metatranscriptome222Y
F028508Metagenome / Metatranscriptome191Y

Sequences

Protein IDFamilyRBSSequence
Ga0247723_100530610F002135N/AMANTRKPIKRKKINRRVVRQTPEISKLDQWYIVKHEIFKTARKAGFSESVALYLMDNPESMPDWIVGDKGIIPTIPTPDEEEE
Ga0247723_100530614F028508GGAGMTKPIIRIHNTETDEIIDREMTAAEFNQYKLDVKEAEAKQAEAEAKAISKSAILDRLGLTADELKTILG
Ga0247723_10053062F020681AGGAMKFRCNFCSSNSEFEWLDGYATADGFRVFQCLKCCAIGTKNLAESTDTQEPVMRCDKCGSWQFVDQKCHTCELIGAN
Ga0247723_10053064F002162N/AMPNYDYICDREGTSIVLDLPMQHEIPLCQVCGFELTRVYTAVPAIFKGDGWAGKK
Ga0247723_10053065F007469AGGAGGMGEMIMIDGSGLTATFTDDGVKVEPSTVVCDACNDDRLLHEGDLLRCYSCHAINLIP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.