NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247723_1003643

Scaffold Ga0247723_1003643


Overview

Basic Information
Taxon OID3300028025 Open in IMG/M
Scaffold IDGa0247723_1003643 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7580
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: West Virginia
CoordinatesLat. (o)39.6017Long. (o)-79.9761Alt. (m)Depth (m)2281
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000166Metagenome / Metatranscriptome1810Y
F002487Metagenome / Metatranscriptome554Y
F104769Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0247723_100364313F104769AGGAMTMKFEMEFGLFNDKLVIETHDFDIIEIFQKFVEFQETHGWAIDYVAVELNDGAFDEEEAIPDFALNAHEPL
Ga0247723_100364316F000166AGGMPNIPTPEHAELFALSVRKWQQVLSLGDWRIEKGSKPAKQAMASVEFTPNARLAVYRIGDFGAEKITPESLDRTALHELLHIFLHDLMVVSQDPKSSQDEIEMQEHRVINLLENLLFRNSNGGC
Ga0247723_10036436F002487N/AMITRQDAIKDLSHGEYCCYCTEQKTYGSCCGENHFVPFEDLYDDDKEEMIKEYLSKGN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.