NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256382_1008293

Scaffold Ga0256382_1008293


Overview

Basic Information
Taxon OID3300028022 Open in IMG/M
Scaffold IDGa0256382_1008293 Open in IMG/M
Source Dataset NameSeawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1894
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location
Location NameMediterranean Sea
CoordinatesLat. (o)34.0321Long. (o)27.821Alt. (m)Depth (m)750
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001651Metagenome / Metatranscriptome657Y
F004769Metagenome / Metatranscriptome424Y
F011621Metagenome289Y

Sequences

Protein IDFamilyRBSSequence
Ga0256382_10082933F001651GGAGVALNNGKALAAENRRSQVLQLKQAGETETAIAELVGVSKTQVHNDIHRRLAEVRRDDKQAVQQEYNLQRSRYERLLLRWWSQATGPDDERAAKATQMVLDILRRLDTIGGLIPEKPLIQLQQQNVMVGGVTFADLLREAMDGAGQIVEGERVDMGTNLAVEN
Ga0256382_10082934F011621GGAGGMPDIGDICRARDLGMVGGRLYIWAECPVCNLQRWANTRPLDKGTRRKCQDCVREKSKRVFKIGRAHTIDQV
Ga0256382_10082936F004769N/AINGFTWRVYGARTGQRFHCHLVELVGPLPLDGPVTQPLRDKIRTELAKALELPESEVARIPADLILA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.