Scaffold Ga0209705_10118893

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209705_10118893

Scaffold Ga0209705_10118893

Overview

Basic Information
Taxon OID	3300027979 Open in IMG/M
Scaffold ID	Ga0209705_10118893 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1430
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division KSB1 → unclassified candidate division KSB1 → candidate division KSB1 bacterium 4484_219	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Name	near Jamestown, North Dakota
Coordinates	Lat. (^o)	47.0991	Long. (^o)	-99.1044	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028847	Metagenome	190	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209705_101188931	F028847	AGGAGG	MQEERRLFNLREFEKMLKSHYKKQNSDLEVSCRDTKFVTYVIHEKGKPWARSLTTEEAFTEIAKILFPHEDVRIVRMQTDPPKVELIIEKS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.