NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207428_10274588

Scaffold Ga0207428_10274588


Overview

Basic Information
Taxon OID3300027907 Open in IMG/M
Scaffold IDGa0207428_10274588 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1252
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006187Metagenome / Metatranscriptome379Y
F056649Metagenome / Metatranscriptome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0207428_102745881F056649GGAGMRTNKTVAASVIVALLLIAVVAGAAADEKTITGVITKVDPTTRIATVTPASGPAIFVQFAFNAGGPCDACLGSGRSGPTFAETVT
Ga0207428_102745882F006187GGAMSRLSGATIVLATVLVAGAFPRAAGAECALDSVASSEEIAAGWTIHEDRRIVKQMDGSPYEQGRGNWFIDRETTTIPMCSVFDDLGGYSLRSYMQQPVVAKTKVQICRATADGGSARFIALDAKPRPSDTPYEVYEPFNRPYLGSCPPRSRASNVIPRSK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.