NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207428_10000033

Scaffold Ga0207428_10000033


Overview

Basic Information
Taxon OID3300027907 Open in IMG/M
Scaffold IDGa0207428_10000033 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)232081
Total Scaffold Genes212 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)168 (79.25%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009935Metagenome / Metatranscriptome311Y
F015535Metagenome / Metatranscriptome254Y
F028854Metagenome / Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0207428_10000033102F028854GGAGGMTTCRCGGLFTLDKAHISEARRFACLATTRLAWTCRLCGHSLWLDQSMSPEDLDAPLETVEARPVA
Ga0207428_10000033114F015535GAGGMRDEITKLIHDYGDAFRLGPSAIAEFYWEPCVTVRTGVVRVNQTREDTERLFTEVGESYRARGFTYGEALAIDVQPLGVNSALATVQWAYNGACAELLWKTTFSYNLHRRGGVWKILVQTMHDS
Ga0207428_10000033150F009935GGAGMDTDEIGRLLKESLDTQREHLAEYRRVTERSLDLQQRAVARQEQMVQVYRKLLIIGGGLVSILLMLLVYLLIRYSRQLFGI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.